SUBSTANCE P (1-7)(68060-49-1)
- Name: SUBSTANCE P (1-7)
- Synonyms:SubstanceP, 8-de-L-phenylalanine-9-deglycine-10-de-L-leucine-11-de-L-methioninamide-;12: PN: US20020037833 SEQID: 12 unclaimed sequence; 12: PN: US20030165541SEQID: 12 unclaimed sequence; 16: PN: WO0207759 SEQID: 12 unclaimed sequence;3: PN: US6641820 SEQID: 12 unclaimed sequence; 435: PN: WO0069900 SEQID: 619unclaimed sequence; 515: PN: US20090175821 SEQID: 619 claimed protein;Substance P(1-7)
- Molecular Formula:C41H65 N13 O10
- Molecular Weight:900.048
- CAS Registry Number:68060-49-1
- EINECS:
- Melting Point:
- Water Solubility:
CAS No.68060-49-1 SUBSTANCE P (1-7)
Assay:99% Appearance:powder Package:Inside plastic outside Storage:Store at -20掳C Transportation:We ship goods via DHL, Fedex, UPS, TNT, China post, NL Post and other couriers, weight from 1g to 1000kg or even bulker Application:Scientific research
Min. Order:1Gram
Supplier:Hebei Nengqian Chemical Import and Export Co., LTD [
China (Mainland)]
CAS No.68060-49-1 SUBSTANCE P (1-7)
Assay:99% Appearance:powder or liquid Package:according to customer requirements Storage:store in dry dark and ventilated place Transportation:By Sea/Air/Courier Application:It is an important raw material.
Min. Order:10Gram
Supplier:Zibo Hangyu Biotechnology Development Co., Ltd [
China (Mainland)]
CAS No.68060-49-1 1-7-SubstanceP
Assay:99.0% Appearance:liquid Package:Grams, Kilograms Storage:Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials. Transportation:According to customer request Application:For R&D and commerical use
Min. Order:100Gram
Supplier:Chemlyte Solutions [
China (Mainland)]
CAS No.68060-49-1 Substance P (1-7)
Assay:98%Min Appearance:detailed in specifications Package:according to the clients requirement Storage:Store in dry, dark and ventilated place. Transportation:by air or by ocean shipping Application:An important raw material and intermediate used in Organic Synthesis, Pharmaceuticals
Min. Order:0
Supplier:Dayang Chem (Hangzhou) Co.,Ltd. [
China (Mainland)]
CAS No.68060-49-1 substance P fragment 1-7
Assay:99.90% Appearance:solid or liquid Package:drum and bag Storage:in sealed air resistant place Transportation:by sea or air Application:for pharma use
Min. Order:0
Supplier:Kono Chem Co.,Ltd [
China (Mainland)]
CAS No.68060-49-1 1-7-SubstanceP
Assay:99% Transportation:By sea Application:Pharmaceutical industry
Min. Order:0
Supplier:Antimex Chemical Limied [
China (Mainland)]
CAS No.68060-49-1 SUBSTANCE P (1-7)
Assay:99% Application:Used as pharmaceutical intermediate
Min. Order:0
Supplier:Shandong Hanjiang Chemical Co., Ltd. [
China (Mainland)]
CAS No.68060-49-1 SUBSTANCE P (1-7)
Assay:98% Appearance:powder Package:As requested Storage:keep in dry and ventilated Transportation:By air or by sea Application:68060-49-1
Min. Order:1Metric Ton
Supplier:HENAN SUNLAKE ENTERPRISE CORPORATION [
China (Mainland)]
CAS No.68060-49-1 SUBSTANCE P (1-7)
Assay:99%+ Package:25kg,50kg,180kg,200kg,250kg,1000kg锛宑ustomization Storage:Keep it in dry,shady and cool place Transportation:Transit could be DHL,UPS,TNT,EMS,Fedex,and so on.For mass orders, it will be delivered by air or sea.For small order, please expect 3-7 days by UPS DHL EMS.For mass order, please allow 5-8 days. Application:Pharma;Industry;Agricultural;chemical reaserch
Min. Order:1Kilogram
Supplier:Wuhan Circle Star Chem-medical Technology co.,Ltd. [
China (Mainland)]
CAS No.68060-49-1 SUBSTANCE P (1-7)
Assay:99% Package:box or opp package Storage:cool drum Transportation:air or sea Application:SUBSTANCE P (1-7)
Min. Order:1Milligram
Supplier:weifang yangxu group co.,ltd [
China (Mainland)]
CAS No.68060-49-1 Substance P (1-7)
Assay:99%min Appearance:Powder Package:PP bags inside,outside aluminium foil bag Storage:Cool dried place Transportation:Express, sea, air, land. Application:Intermediate,peptides
Min. Order:0
Supplier:Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd [
China (Mainland)]
CAS No.68060-49-1 SUBSTANCE P (1-7)
Assay:99% Appearance:liquid or powder Package:according to the clients requirement Storage:Dry and Cool Place Transportation:UPS FedEx ,DHL,EXPRESS LINE Application:API
Min. Order:1Gram
Supplier:Shandong Mopai Biotechnology Co., LTD [
China (Mainland)]
CAS No.68060-49-1 1-7-SubstanceP
Assay:99% Appearance:white powder Package:drum or based on customers' requirement Storage:normal temperature storage Transportation:by sea, by air Application:We have different specifications for different applications
Min. Order:1Metric Ton
Supplier:Bluecrystal chem-union [
China (Mainland)]
CAS No.68060-49-1 Substance P (1-7)
Assay:99% Appearance:White to light yellow to light orange fluffy powder Package:according to your requirement Storage:White to light yellow to light orange fluffy powder Transportation:by air /by train/by sea Application:lab
Min. Order:1Kilogram
Supplier:Jiangsu Xinsu New Materials Co., Ltd. [
China (Mainland)]
CAS No.68060-49-1 N5-(Diaminomethylene)-L-ornithyl-L-prolyl-L-lysyl-L-prolyl-L-glutaminyl-L-glutaminyl-L-phenylalanine CAS No.68060-49-1
Assay:99.90% Appearance:solid or liquid Package:As customer's requested Storage:sealed in cool and dry place Transportation:by courier/air/sea Application:Pharma Intermediate
Min. Order:0
Supplier:Guangdong Juda Chemical Industrial Co.,Limited [
China (Mainland)]
CAS No.68060-49-1 1-7-Substance P
Assay:98.5% Appearance:white/off-white or light yellow Package:aluminum bottle,glass bottle,PTFE bottle,cardboard drum Storage:Store in cool and dry place, keep away from strong light and heat. Transportation:by courier, by air, by sea Application:This product can be used in food/pharmaceutical/cosmetical industry
Min. Order:0
Supplier:Suzhou Health Chemicals Co., Ltd. [
China (Mainland)]
CAS No.68060-49-1 Substance P Fragment 1-7 manufacturer
Assay:鈮?7% (HPLC) Appearance:White powder Package:According client's requirements Storage:keep sealed and keep from direct light Transportation:According client's requirements Application:pharmaceutical
Min. Order:0
Supplier:Shanghai Yuanye Bio-Technology Co., Ltd. [
China (Mainland)]
CAS No.68060-49-1 Substance P (1-7)
Assay:鈮?7% by HPLC Appearance:White Powder Storage:Store at -20掳C Application:For research use only.
Min. Order:0
Supplier:BOC Sciences [
United States]
CAS No.68060-49-1 Substance P Fragment 1-7
Assay:98% Application:chemical reagent
Min. Order:0
Supplier:SHANDONG BENRITE NEW CHEMICAL MATERIALS CO.,LTD. [
China (Mainland)]
CAS No.68060-49-1 SUBSTANCE P (1-7)
Assay:98% Package:According to the demand of customer Storage:Sealed, dry, microtherm , avoid light and smell. Transportation:by air or by sea Application:Organic synthesis
Min. Order:0
Supplier:Henan Allgreen Chemical Co.,Ltd [
China (Mainland)]

Other Product
- 5892-11-5/BRUCINE
- 55750-62-4/N-Succinimidyl 3-maleimidopropionate
- 209127-01-5/1-(4-Fluorphenyl)-2-methyl-2-morpholino-1-propanone
- 15445-77-9/FMOC-ARG(PBF)-OH
- 129121-73-9/ALPHA-CGRP (8-37) (RAT)
- 92000-76-5/HA PEPTIDE
- 125911-68-4/SAMS PEPTIDE
- 73572-58-4/BOC-PHE-D-LEU-PHE-D-LEU-PHE-OH
- 187986-11-4/H-TRP-LYS-TYR-MET-VAL-MET-NH2
- 10010-67-0/Sodium hydrogen piperazine-1,4-diethanesulphonate
- 100930-02-7/ARG-TYR-LEU-PRO-THR ACETATE SALT
- 183598-56-3/LEPTIN (22-56), HUMAN
- 357952-10-4/FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
- 102029-74-3/H-TYR-PRO-PHE-VAL-GLU-PRO-ILE-OH
- 217082-58-1/GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE
- 123338-10-3/ALLATOSTATIN I
- 357952-09-1/STRESSCOPIN (3-40) (HUMAN) TRIFLUOROACETATE SALT
- 145854-61-1/MASTOPARAN 17
- 68060-49-1/SUBSTANCE P (1-7)
- 4988-64-1/6-MERCAPTOPURINE RIBOSIDE
- 146692-40-2/4,5-DIAMINO-6-THIOURACIL HEMISULFATE
- 824-27-1/4,5-DIAMINO-3-METHYL-6-OXOPYRIMIDINE
- 37390-66-2/2,6-Dichloropurine-2'-deoxyriboside
- 28976-77-4/3-BROMO-2-METHYLACRYLONITRILE
- 51269-82-0/5-CHLORO-3-CYANOPYRIDINE
- 21992-70-1/1,4-DIOXANE DIBROMIDE
- 82144-78-3/2-BROMOPENTADECANOIC ACID
- 166328-16-1/2-FLUORO-5-METHYLPHENYLBORONIC ACID
- 173999-18-3/5-Methylpyridine-3-boronic acid
- 175883-60-0/3-Chloro-4-methoxyphenylboronic acid