HA PEPTIDE(92000-76-5)
- Name: HA PEPTIDE
- Synonyms:L-Alanine,N-[N-[N-[1-[N-[N-[N-(1-L-tyrosyl-L-prolyl)-L-tyrosyl]-L-a-aspartyl]-L-valyl]-L-prolyl]-L-a-aspartyl]-L-tyrosyl]-; 105: PN:WO0026408 SEQID: 38 claimed protein; 109: PN: US20100041098 SEQID: 109unclaimed protein; 109: PN: WO2006099590 SEQID: 109 unclaimed sequence; 109: PN:WO2007106115 SEQID: 109 unclaimed sequence; 10: PN: US20050136062 SEQID: 10unclaimed sequence; 10: PN: WO0105998 SEQID: 20 unclaimed sequence; 10: PN:WO0114404 SEQID: 10 unclaimed sequence; 10: PN: WO0185962 SEQID: 10 unclaimedsequence; 10: PN: WO03014310 SEQID: 10 unclaimed sequence; 10: PN: WO2008155304PAGE: 4 unclaimed sequence; 10: PN: WO2009052971 SEQID: 5 claimed sequence;113: PN: WO0050872 SEQID: 38 unclaimed sequence; 11: PN: FR2857969 SEQID: 11unclaimed protein; 11: PN: JP2004215616 SEQID: 11 unclaimed protein; 11: PN:WO2005072159 SEQID: 11 unclaimed sequence; 11: PN: WO2005087811 SEQID: 5unclaimed sequence; 11: PN: WO2007087370 SEQID: 11 unclaimed sequence; 11: PN:WO2007087412 SEQID: 11 unclaimed sequence; 11: PN: WO2007089659 SEQID: 11unclaimed sequence; 11: PN: WO2007089690 SEQID: 11 unclaimed sequence; 11: PN:WO2007089783 SEQID: 11 unclaimed sequence; 11: PN: WO2007089792 SEQID: 11unclaimed sequence; 11: PN: WO2007089793 SEQID: 11 unclaimed sequence; 11: PN:WO2008005556 SEQID: 15 unclaimed sequence; 11: PN: WO2008013816 SEQID: 11unclaimed sequence; 11: PN: WO2008121007 SEQID: 11 unclaimed sequence; 11: PN:WO2008133164 SEQID: 14 unclaimed protein; 127: PN: US20060024781 SEQID: 127unclaimed sequence; 12: PN: CN101285055 TABLE: 1 unclaimed sequence; 12: PN:US20030215424 SEQID: 12 unclaimed protein; 12: PN: US20050014935 SEQID: 12unclaimed protein; 12: PN: US20080089901 SEQID: 12 claimed protein; 12: PN:US6420111 SEQID: 79 unclaimed protein; 12: PN: US6518480 SEQID: 12 unclaimed protein;12: PN: WO2004087736 SEQID: 12 unclaimed sequence; 12: PN: WO2005013666 SEQID:14 claimed sequence; 12: PN: WO2005078076 SEQID: 2 unclaimed sequence; 12: PN:WO2005107381 PAGE: 19 unclaimed sequence;
- Molecular Formula:C53H67 N9 O17
- Molecular Weight:1102.17
- CAS Registry Number:92000-76-5
- EINECS:
- Melting Point:
- Water Solubility:
CAS No.92000-76-5 HA PEPTIDE
Assay:99% Appearance:white powder Package:According to the customer's requestment Storage:Store in dry, dark and ventilated plac... Transportation:Fast! Safe! Promise 100% safe and successful transportation. Door to door transportation services. Application:Pharmaceutical intermediates
Min. Order:1Kilogram
Supplier:RongNa Biotechnology Co., Ltd [
China (Mainland)]
CAS No.92000-76-5 HA PEPTIDE
Assay:99% Appearance:powder Package:Inside plastic outside Storage:Store at -20掳C Transportation:We ship goods via DHL, Fedex, UPS, TNT, China post, NL Post and other couriers, weight from 1g to 1000kg or even bulker Application:Scientific research
Min. Order:1Gram
Supplier:Hebei Nengqian Chemical Import and Export Co., LTD [
China (Mainland)]
CAS No.92000-76-5 HA PEPTIDE
Assay:99% Appearance:powder or liquid Package:according to customer requirements Storage:store in dry dark and ventilated place Transportation:By Sea/Air/Courier Application:It is an important raw material.
Min. Order:10Gram
Supplier:Zibo Hangyu Biotechnology Development Co., Ltd [
China (Mainland)]
CAS No.92000-76-5 HA PEPTIDE
Assay:90%,98% Appearance:detailed see specifications Package:according to the clients requirement Storage:Store in dry, dark and ventilated place. Transportation:by air or by sea Application:Used in Synthesis, Pharmaceuticals and other fields
Min. Order:1Kilogram
Supplier:Dayang Chem (Hangzhou) Co.,Ltd. [
China (Mainland)]
CAS No.92000-76-5 HA PEPTIDE
Assay:99% Application:Used as pharmaceutical intermediate
Min. Order:0
Supplier:Shandong Hanjiang Chemical Co., Ltd. [
China (Mainland)]
CAS No.92000-76-5 HA Peptide (HA tag)
Assay:99%+ Appearance:white powder Package:25kg,50kg,180kg,200kg,250kg,1000kg锛宑ustomization Storage:Keep it in dry,shady and cool place Transportation:Transit could be DHL,UPS,TNT,EMS,Fedex,and so on. For mass orders, it will be delivered by air or sea. For small order, please expect 3-7 days by UPS DHL EMS. For mass order, please allow 5-8 days. Application:Pharma;Industry;Agricultural;chemical reaserch
Min. Order:1Kilogram
Supplier:Wuhan Circle Star Chem-medical Technology co.,Ltd. [
China (Mainland)]
CAS No.92000-76-5 HA Peptide (HA tag)
Assay:0.99 Appearance:white powder Package:25kg,50kg,180kg,200kg,250kg,1000kg锛宑ustomization Storage:Keep it in dry,shady and cool place Transportation:by express or by sea Application:Pharma;Industry;Agricultural;chemical reaserch
Min. Order:0
Supplier:Wuhan Circle Star Chem-medical Technology co.,Ltd. [
China (Mainland)]
CAS No.92000-76-5 HA PEPTIDE
Assay:99% Package:box or opp package Storage:cool drum Transportation:air or sea Application:HA PEPTIDE
Min. Order:1Milligram
Supplier:weifang yangxu group co.,ltd [
China (Mainland)]
CAS No.92000-76-5 HA PEPTIDE
Assay:99 Appearance:powder, or liquid Package:Bottle, barrel, cargo, container, etc. Storage:Stored in room temperature, ventilated place Transportation:By air, ship, express, etc. Application:Pharmaceuticals, intermediates, APIs, custom synthesis, chemicals
Min. Order:0
Supplier:LEAP CHEM Co., Ltd. [
China (Mainland)]
CAS No.92000-76-5 Manufacturer supply CAS 92000-76-5 with best quality
Assay:99% Appearance:White powder Package: [Packaging]20mg, 50mg,100mg,1g,10g,100g,according to customers' requirements Storage: should be stored in a well-closed container at low temperature, keep away from moisture, heat and light. Transportation:1. Samples 1kg-10kg are shipped by international express. 2. 50kg-100kg of goods are transported by dedicated line logistics. 3. Cargo 100kg-1ton is transported by dedicated line logistics. Application:Chemical raw materials, pharmaceutical intermediates, cosmetic raw materials, etc.
Min. Order:1Kilogram
Supplier:Zhuozhou Wenxi import and Export Co., Ltd [
China (Mainland)]
CAS No.92000-76-5 HA PEPTIDE
Assay:99% Appearance:liquid or powder Package:according to the clients requirement Storage:Dry and Cool Place Transportation:UPS FedEx ,DHL,EXPRESS LINE Application:API
Min. Order:1Gram
Supplier:Shandong Mopai Biotechnology Co., LTD [
China (Mainland)]
CAS No.92000-76-5 Influenza Hemagglutinin (HA) Peptide manufacturer
Assay:鈮?7% (HPLC) Appearance:White powder Package:According client's requirements Storage:keep sealed and keep from direct light Transportation:According client's requirements Application:pharmaceutical
Min. Order:0
Supplier:Shanghai Yuanye Bio-Technology Co., Ltd. [
China (Mainland)]
CAS No.92000-76-5 HA Peptide
Assay:鈮?7% by HPLC Storage:Store at -20掳C Application:For research use only.
Min. Order:0
Supplier:BOC Sciences [
United States]
CAS No.92000-76-5 HA PEPTIDE
Assay:98% Package:According to the demand of customer Storage:Sealed, dry, microtherm , avoid light and smell. Transportation:by air or by sea Application:Organic synthesis
Min. Order:0
Supplier:Henan Allgreen Chemical Co.,Ltd [
China (Mainland)]

Other Product
- 71496-78-1/LANTHANUM ALUMINATE
- 393-85-1/2-NITRO-5-FLUOROBENZOIC ACID, METHYL ESTER
- 169396-88-7/N-[2-(FMOC-AMINO)-ETHYL]GLYCINE TERT-BUTYL ESTER HYDROCHLORIDE
- 235-21-2/[1,2,3]Triazolo[1,5-a]quinoline
- 166108-71-0/[2-[2-(Fmoc-amino)ethoxy]ethoxy]acetic acid
- 78539-91-0/7-METHYL-1,2,3-TRIAZOLO(1,5-A)PYRIDINE
- 72648-80-7/ETHYL [2-(BOC-AMINO)ETHYLAMINO]ACETATE HYDROCHLORIDE
- 195986-91-5/5-HYDROXY ISATOIC ANHYDRIDE
- 169287-77-8/BOC-PNA-G(Z)-OH
- 947-88-6/3-(2-PYRIDYL)-1,2,3-TRIAZOLO(1,5-A)PYRIDINE
- 139166-80-6/BOC-PNA-T-OH
- 2032-75-9/2,2-Dichloro-1,3-benzodioxole
- 27428-57-5/4-BROMO-4'-CHLOROBENZOPHENONE
- 32665-23-9/FEMA 2961
- 5892-11-5/BRUCINE
- 55750-62-4/N-Succinimidyl 3-maleimidopropionate
- 209127-01-5/1-(4-Fluorphenyl)-2-methyl-2-morpholino-1-propanone
- 15445-77-9/FMOC-ARG(PBF)-OH
- 129121-73-9/ALPHA-CGRP (8-37) (RAT)
- 92000-76-5/HA PEPTIDE
- 125911-68-4/SAMS PEPTIDE
- 73572-58-4/BOC-PHE-D-LEU-PHE-D-LEU-PHE-OH
- 187986-11-4/H-TRP-LYS-TYR-MET-VAL-MET-NH2
- 10010-67-0/Sodium hydrogen piperazine-1,4-diethanesulphonate
- 100930-02-7/ARG-TYR-LEU-PRO-THR ACETATE SALT
- 183598-56-3/LEPTIN (22-56), HUMAN
- 357952-10-4/FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
- 102029-74-3/H-TYR-PRO-PHE-VAL-GLU-PRO-ILE-OH
- 217082-58-1/GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE
- 123338-10-3/ALLATOSTATIN I