Sodium hydrogen piperazine-1,4-diethanesulphonate(10010-67-0)
- Name: Sodium hydrogen piperazine-1,4-diethanesulphonate
- Synonyms:1,4-Piperazinediethanesulfonicacid, monosodium salt (8CI,9CI);PIPES monosodium salt;Piperazine-1,4-diethanesulfonatesodium salt;Sodium hydrogen piperazine-1,4-diethanesulfonate;
- Molecular Formula:C8H18N2NaO6S2
- Molecular Weight:325.35
- CAS Registry Number:10010-67-0
- EINECS:233-005-3
- Melting Point:300 °C
- Water Solubility:Soluble in water
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:98% Appearance:Detailed see specifications Package:according to the clients requirement Storage:Store in dry, dark and ventilated place. Transportation:by sea or by air Application:It is an important raw material and intermediate used in Organic Synthesis, Pharmaceuticals, Agrochemicals and Dyestuff.
Min. Order:1Kilogram
Supplier:Dayang Chem (Hangzhou) Co.,Ltd. [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:99.0%Min Appearance:White powder Package:as requested Storage:Room Temperature Transportation:by sea,air Application:For pharmacy chemical
Min. Order:1Kilogram
Supplier:HENAN NEW BLUE CHEMICAL CO.,LTD [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:99%min. Appearance:white powder Package:1kg/Export worthy packing; 25kg/drum Storage:In well-closed container, protected from light and in cool & dry place. Transportation:By Air, By Sea, By courier (door to door, DHL/FedEx/UPS) Application:R&D and production for pharmaceuticals and chemicals
Min. Order:1Gram
Supplier:LIDE PHARMACEUTICALS LIMITED [
China (Mainland)]
CAS No.10010-67-0 PIPES-Na
Assay:99%min Appearance:white powder Package:By foil-alum bag or pap Storage:Place in a dry, ventilated place. Transportation:By courier, air or sea. Application:intermediate
Min. Order:1Gram
Supplier:Hangzhou Dingyan Chem Co., Ltd [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:99% purity Appearance:white crystalline powder Package:According to the need to packing Storage:sealed,dry,low temperature Transportation:air,sea and courier Application:buffer
Min. Order:1Gram
Supplier:Shanghai Minstar Chemical Co., Ltd [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:99% Package:According to customer requirements Transportation:By Sea/Air/Courier Application:medicine
Min. Order:10Gram
Supplier:Zibo Hangyu Biotechnology Development Co., Ltd [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:99% Package:According client's requirements Transportation:by sea/by air/by courier Application:Chemical products
Min. Order:1Kilogram
Supplier:Hangzhou ZeErRui Chemical Co., Ltd. [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:99% Appearance:white powder Package:According to the customer's requestment Storage:Store in dry, dark and ventilated plac... Transportation:Fast! Safe! Promise 100% safe and successful transportation. Door to door transportation services. Application:Pharmaceutical intermediates
Min. Order:1Kilogram
Supplier:RongNa Biotechnology Co., Ltd [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine -1,4-diethanesulphonate
Assay:鈮?9% Appearance:White powder Package:Inside plastic outside Storage:Stored in a clean, cool, dry area; keep away from moisture and strong, direct light/heat Transportation:Transport锛? EMS,DHL, TNT, UPS ,FEDEX, BY AIR, BY SEA DHL Express, FedEx and EMS for quantity less than 50KG, usually called as DDU service; Sea shipping for quantity over 500KG; And air shipping i Application:Biological buffers
Min. Order:1Kilogram
Supplier:Hebei Nengqian Chemical Import and Export Co., LTD [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:鈮?9% Appearance:White to Almost white powder Package:drum Storage:room temp Transportation:according to your demand Application:Pharm intermediate
Min. Order:1Gram
Supplier:HANGZHOU TIANYE CHEMICALS CO., LTD. [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:99% Appearance:White fine powder Package:according to the clients requirement Transportation:Transportation by express, air, sea; port mainly to Qingdao / Tianjin / Shanghai, or according to customer needs to send different ports and aviation. Application:An important raw material and intermed
Min. Order:1Kilogram
Supplier:Shandong Hanjiang Chemical Co., Ltd. [
China (Mainland)]
CAS No.10010-67-0 PIPESmonosodiumsalthydrate,99%
Assay:99.0% Appearance:liquid Package:Grams, Kilograms Storage:Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials. Transportation:According to customer request Application:For R&D and commerical use
Min. Order:100Gram
Supplier:Chemlyte Solutions [
China (Mainland)]
CAS No.10010-67-0 Cheap Price Ready Stock PIPESmonosodiumsalt
Assay:99% Appearance:White to Almost white powder to crystal Package:25kg/Barrel Storage:R T Transportation:Express/Sea/Air Application:Biological buffers
Min. Order:1Kilogram
Supplier:Hangzhou Sartort Biopharma Co., Ltd [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:NLT 98% Appearance:White powder Package:Aluminum bag/Carton Drum Storage:Store in a tightly closed container, in a cool and dry place. Transportation:By air Application:Used in producing API
Min. Order:0
Supplier:Hangzhou Huarong Pharm Co., Ltd. [
China (Mainland)]
CAS No.10010-67-0 PIPES-NA|PIPES Monosodium Salt
Assay:99% Appearance:White Powder Package:25KG/Drum Storage:Preserve in tight, light-resistant containers Transportation:By Air& By Sea Application:Pharmaceutical
Min. Order:0
Supplier:Golden Pharma Co., Limited [
China (Mainland)]
CAS No.10010-67-0 SodiuM 2-(4-(2-sulfoethyl)piperazin-1-yl)ethanesulfonate
Assay:57% Appearance:white solid Package:Plastic-woven sack with polythene inner bag; Net weight 25kg, 50kg or 1000kg; Keep away from water or moisture, do not pile up in the open air. 23MT/20'FCL Storage:Stored in shaded, cool and dry places Transportation:Handle with cares to avoid damaging the packages. Protect them from sunshine or rain. We can send by Fedex, by ship or by plane according to international rules. Application:pharma intermediate
Min. Order:0
Supplier:Antimex Chemical Limied [
China (Mainland)]
CAS No.10010-67-0 SODIUM HYDROGEN PIPERAZINE-1,4-DIETHANESULPHONATE
Assay:99% Appearance:detailed see specifications Package:according to the clients requirement Storage:Store in dry, dark and ventilated place. Transportation:by sea or by air Application:An important raw material and intermediate used in Organic Synthesis, Pharmaceuticals
Min. Order:1Gram
Supplier:Afine Chemicals Limited [
China (Mainland)]
CAS No.10010-67-0 PIPES monosodium salt
Assay:99.90% Appearance:solid or liquid Package:drum and bag Storage:in sealed air resistant place Transportation:by sea or air Application:for pharma use
Min. Order:0
Supplier:Kono Chem Co.,Ltd [
China (Mainland)]
CAS No.10010-67-0 Piperazine-N,N'-bis-(2-ethanesulfonic acid) monosodium salt
Assay:98%min Package:25kg/drum,or as per customers'demand Transportation:air,sea,courier Application:API,or Intermediates,fine chemicals
Min. Order:0
Supplier:GIHI CHEMICALS CO.,LIMITED [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:99% Application:Medical research field
Min. Order:0
Supplier:Qingdao Beluga Import and Export Co., LTD [
China (Mainland)]
CAS No.10010-67-0 1,4-Piperazinediethanesulfonicacid, sodium salt (1:1)
Assay:98%min Appearance:Off-white to light yellow powder Package:According to the clients requirement. Storage:Keep in cool place. Application:Pharmaceutical intermediates
Min. Order:0
Supplier:Hangzhou J&H Chemical Co., Ltd. [
China (Mainland)]
CAS No.10010-67-0 10010-67-0 C8H17N2NaO6S2 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:57% Appearance:white solid Package:Plastic-woven sack with polythene inner bag; Net weight 25kg, 50kg or 1000kg; Keep away from water or moisture, do not pile up in the open air. 23MT/20'FCL Storage: Plastic-woven sack with polythene inner bag; Net weight 25kg, 50kg or 1000kg; Keep away from water or moisture, do not pile up in the open air. 23MT/20'FCL Transportation:by sea or by express Application:buffer
Min. Order:21Metric Ton
Supplier:HENAN SUNLAKE ENTERPRISE CORPORATION [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:99% Package:box or opp package Storage:cool drum Transportation:air or sea Application:Sodium hydrogen piperazine-1,4-diethanesulphonate
Min. Order:1Milligram
Supplier:weifang yangxu group co.,ltd [
China (Mainland)]
CAS No.10010-67-0 1,4-Piperazinediethanesulfonicacid, sodium salt (1:1)
Assay:99% Package:drum Transportation:By Sea/Air/DHL Application:Henan Wentao Chemical Product Co., Ltd.
Min. Order:0
Supplier:Henan Wentao Chemical Product Co., Ltd. [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:99 Appearance:powder, or liquid Package:Bottle, barrel, cargo, container, etc. Storage:Stored in room temperature, ventilated place Transportation:By air, ship, express, etc. Application:Pharmaceuticals, intermediates, APIs, custom synthesis, chemicals
Min. Order:0
Supplier:LEAP CHEM Co., Ltd. [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:99.90% Appearance:solid or liquid Package:Foil bag; Drum; Plastic bottle Storage:in sealed air resistant place Transportation:by sea or air Application:Pharma;Industry;Agricultural
Min. Order:0
Supplier:Xi`an Eastling Biotech Co., Ltd. [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:99% Appearance:white powder Package:25kg,50kg,180kg,200kg,250kg,1000kg锛宑ustomization Storage:Keep it in dry,shady and cool place Transportation:by express or by sea Application:Pharma;Industry;Agricultural;chemical reaserch
Min. Order:0
Supplier:Wuhan Circle Star Chem-medical Technology co.,Ltd. [
China (Mainland)]
CAS No.10010-67-0 Pharmaceutical Grade CAS 10010-67-0 with competitive price
Assay:99% Appearance:White powder Package: [Packaging]20mg, 50mg,100mg,1g,10g,100g,according to customers' requirements Storage: should be stored in a well-closed container at low temperature, keep away from moisture, heat and light. Transportation:1. Samples 1kg-10kg are shipped by international express. 2. 50kg-100kg of goods are transported by dedicated line logistics. 3. Cargo 100kg-1ton is transported by dedicated line logistics. Application:Raw materials in the pharmaceutical field
Min. Order:10Kilogram
Supplier:Zhuozhou Wenxi import and Export Co., Ltd [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:99%min Appearance:white or almost white powder Package:1kg/drum, 25kg/drum, 200kg/drum,500kg/drum Storage:Keep it in dry, cool and ventilated place Transportation:by sea or by air Application:For scientific research
Min. Order:1Kilogram
Supplier:Shanghai Seasonsgreen Chemical Co.,Ltd [
China (Mainland)]
CAS No.10010-67-0 Piperazine-N,N'-bis-2-ethanesulfonic acid monosodium salt
Assay:99% Haccp,,Halal,SC US FDA GMP ISO14001 Appearance:As per Certificate of analysis and our TDS, MSDS Package:Export standard and according to the clients requirement Storage:Store in dry, dark and ventilated place;ISO / Kosher /GMP licence commercial bulk capacity factory in China Transportation:By AIR or by SEA GMP licence / US-FDA,South Korea-KFDA Application:It is an important raw material and intermediate for chemical industry.
Min. Order:5Kiloliter
Supplier:Chemwill Asia Co., Ltd. [
China (Mainland)]
CAS No.10010-67-0 Sodium 2-(4-(2-sulfoethyl)piperazin-1-yl)ethanesulfonate
Assay:97% Appearance:Powder or liquid Package:According to customer Storage:Store in a tightly closed container, in a cool and dry place. Transportation:Fedex,DHL,TNT,BY SEA and BY AIR Application:Medicinal Chemistry Biomedicine Pharmaceutical intermediates Chemistry experiment Biological experiments Chemical reagent For R&D use only.
Min. Order:10Milligram
Supplier:Amadis Chemical Co., Ltd. [
China (Mainland)]
CAS No.10010-67-0 PIPES monosodium salt
Assay:99% Appearance: White powder Package:25kg Storage:Store in cool and dry place, away from sun light. Transportation:By sea or by air Application:Biological Buffers
Min. Order:1Kilogram
Supplier:Henan Sinotech Import&Export Corporation [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:99% Appearance:powder Package:1kg/bag; 101kg/drum, or as customer's required Storage:Keep in a cool & dry place Transportation:by air/by sea
Min. Order:0Metric Ton
Supplier:Jiangsu Congzhong Chemical Co., Ltd. [
China (Mainland)]
CAS No.10010-67-0 Factory Supply PIPES monosodium salt
Assay:99% Appearance:powder or granule ( refer to COA) Package:25kgs/fiber drum Storage:Keep in a cool & dry place Transportation:by sea or by air Application:Librium, Valium
Min. Order:0
Supplier:Ality Chemical Corporation [
China (Mainland)]
CAS No.10010-67-0 PIPES monosodium salt
Assay:97% Appearance:white to yellow crystal powder Package:according to the clients requirement Storage:Room temperature with sealed well Transportation:by sea or by air Application:Use as primary and secondary intermediate
Min. Order:0
Supplier:BOC Sciences [
United States]
CAS No.10010-67-0 Piperazine-N,N'-bis(2-ethanesulfonic acid), monosodium salt 10010-67-0
Assay:96% Appearance:solid or liquid Package:Foil bag; Drum; Plastic bottle Storage:in sealed air resistant place Transportation:by sea or air Application:Pharma;Industry;Agricultural
Min. Order:0
Supplier:Hunan Russell Chemicals Technology Co.,Ltd [
China (Mainland)]
CAS No.10010-67-0 PIPES Monosodium salt
Assay:Pure Appearance:Powder Package:10G/bottle 1kg/tin 5kg/tin 25kg/carton Storage:Store in dry, cool and ventilated place Transportation:By sea By air By courier Application:Biology reagent
Min. Order:0
Supplier:Asure Biochem CO.,LTD. [
China (Mainland)]
CAS No.10010-67-0 PIPES Monosodium salt manufacturer
Assay:99% Appearance:White powder Package:According client's requirements Storage:keep sealed and keep from direct light Transportation:by express or by sea Application:pharmaceutical
Min. Order:0
Supplier:Shanghai Yuanye Bio-Technology Co., Ltd. [
China (Mainland)]
CAS No.10010-67-0 Piperazine-N,N'-bis(2-ethanesulfonic acid), monosodium salt
Appearance:95%+ Package:R&D,Pilot run Transportation:per client require
Min. Order:0
Supplier:Hunan chemfish Pharmaceutical co.,Ltd [
China (Mainland)]
CAS No.10010-67-0 Sodium hydrogen piperazine-1,4-diethanesulphonate
Assay:98% Package:According to the demand of customer Storage:Sealed, dry, microtherm , avoid light and smell. Transportation:by air or by sea Application:Organic synthesis
Min. Order:0
Supplier:Henan Allgreen Chemical Co.,Ltd [
China (Mainland)]
- Dayang Chem (Hangzhou) Co.,Ltd.

Other Product
- 166108-71-0/[2-[2-(Fmoc-amino)ethoxy]ethoxy]acetic acid
- 78539-91-0/7-METHYL-1,2,3-TRIAZOLO(1,5-A)PYRIDINE
- 72648-80-7/ETHYL [2-(BOC-AMINO)ETHYLAMINO]ACETATE HYDROCHLORIDE
- 195986-91-5/5-HYDROXY ISATOIC ANHYDRIDE
- 169287-77-8/BOC-PNA-G(Z)-OH
- 947-88-6/3-(2-PYRIDYL)-1,2,3-TRIAZOLO(1,5-A)PYRIDINE
- 139166-80-6/BOC-PNA-T-OH
- 2032-75-9/2,2-Dichloro-1,3-benzodioxole
- 27428-57-5/4-BROMO-4'-CHLOROBENZOPHENONE
- 32665-23-9/FEMA 2961
- 5892-11-5/BRUCINE
- 55750-62-4/N-Succinimidyl 3-maleimidopropionate
- 209127-01-5/1-(4-Fluorphenyl)-2-methyl-2-morpholino-1-propanone
- 15445-77-9/FMOC-ARG(PBF)-OH
- 129121-73-9/ALPHA-CGRP (8-37) (RAT)
- 92000-76-5/HA PEPTIDE
- 125911-68-4/SAMS PEPTIDE
- 73572-58-4/BOC-PHE-D-LEU-PHE-D-LEU-PHE-OH
- 187986-11-4/H-TRP-LYS-TYR-MET-VAL-MET-NH2
- 10010-67-0/Sodium hydrogen piperazine-1,4-diethanesulphonate
- 100930-02-7/ARG-TYR-LEU-PRO-THR ACETATE SALT
- 183598-56-3/LEPTIN (22-56), HUMAN
- 357952-10-4/FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
- 102029-74-3/H-TYR-PRO-PHE-VAL-GLU-PRO-ILE-OH
- 217082-58-1/GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE
- 123338-10-3/ALLATOSTATIN I
- 357952-09-1/STRESSCOPIN (3-40) (HUMAN) TRIFLUOROACETATE SALT
- 145854-61-1/MASTOPARAN 17
- 68060-49-1/SUBSTANCE P (1-7)
- 4988-64-1/6-MERCAPTOPURINE RIBOSIDE